Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (22 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.22: Autophagin-like [159858] (2 proteins) Pfam PF03416 |
Protein Cysteine protease ATG4B [159861] (1 species) Autophagin-1 |
Species Human (Homo sapiens) [TaxId:9606] [159862] (4 PDB entries) Uniprot Q9Y4P1 10-373! Uniprot Q9Y4P1 5-354 |
Domain d2z0ea1: 2z0e A:5-354 [145770] Other proteins in same PDB: d2z0eb1 automatically matched to 2Z0D A:5-354 mutant |
PDB Entry: 2z0e (more details), 1.9 Å
SCOP Domain Sequences for d2z0ea1:
Sequence, based on SEQRES records: (download)
>d2z0ea1 d.3.1.22 (A:5-354) Cysteine protease ATG4B {Human (Homo sapiens) [TaxId: 9606]} tltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggt gptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyys ihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcr tsvpcagatafpadsdrhcngfpagaevtnrpspwrplvlliplrlgltdineayvetlk hcfmmpqslgviggkpnsahyfigyvgeeliyldpattqpaveptdgcfipdesfhcqhp pcrmsiaeldpsiavgffckteddfndwcqqvkklsllggalpmfelveq
>d2z0ea1 d.3.1.22 (A:5-354) Cysteine protease ATG4B {Human (Homo sapiens) [TaxId: 9606]} tltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggt gptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyys ihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcr tspwrplvlliplrlgltdineayvetlkhcfmmpqslgviggkpnsahyfigyvgeeli yldpattqpavepipdesfhcqhppcrmsiaeldpsiavgffckteddfndwcqqvkkls llggalpmfelveq
Timeline for d2z0ea1: