Class b: All beta proteins [48724] (174 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (3 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (11 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein F-box/WD repeat-containing protein 7, FBXW7 [159259] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159260] (3 PDB entries) Uniprot Q969H0 365-706 |
Domain d2ovrb2: 2ovr B:2365-2706 [145736] Other proteins in same PDB: d2ovra1, d2ovra2, d2ovrb1 automatically matched to 2OVP B:2365-2706 complexed with so4 |
PDB Entry: 2ovr (more details), 2.5 Å
SCOPe Domain Sequences for d2ovrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} wrrgelkspkvlkghddhvitclqfcgnrivsgsddntlkvwsavtgkclrtlvghtggv wssqmrdniiisgstdrtlkvwnaetgecihtlyghtstvrcmhlhekrvvsgsrdatlr vwdietgqclhvlmghvaavrcvqydgrrvvsgaydfmvkvwdpetetclhtlqghtnrv yslqfdgihvvsgsldtsirvwdvetgncihtltghqsltsgmelkdnilvsgnadstvk iwdiktgqclqtlqgpnkhqsavtclqfnknfvitssddgtvklwdlktgefirnlvtle sggsggvvwrirasntklvcavgsrngteetkllvldfdvdm
Timeline for d2ovrb2: