Lineage for d2ovrb2 (2ovr B:2365-2706)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960204Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 960290Superfamily b.69.4: WD40 repeat-like [50978] (3 families) (S)
    also contains 8-bladed propellers
  5. 960291Family b.69.4.1: WD40-repeat [50979] (11 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 960340Protein F-box/WD repeat-containing protein 7, FBXW7 [159259] (1 species)
  7. 960341Species Human (Homo sapiens) [TaxId:9606] [159260] (3 PDB entries)
    Uniprot Q969H0 365-706
  8. 960342Domain d2ovrb2: 2ovr B:2365-2706 [145736]
    Other proteins in same PDB: d2ovra1, d2ovra2, d2ovrb1
    automatically matched to 2OVP B:2365-2706
    complexed with so4

Details for d2ovrb2

PDB Entry: 2ovr (more details), 2.5 Å

PDB Description: Structure of the Skp1-Fbw7-CyclinEdegN complex
PDB Compounds: (B:) F-box/WD repeat protein 7

SCOPe Domain Sequences for d2ovrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}
wrrgelkspkvlkghddhvitclqfcgnrivsgsddntlkvwsavtgkclrtlvghtggv
wssqmrdniiisgstdrtlkvwnaetgecihtlyghtstvrcmhlhekrvvsgsrdatlr
vwdietgqclhvlmghvaavrcvqydgrrvvsgaydfmvkvwdpetetclhtlqghtnrv
yslqfdgihvvsgsldtsirvwdvetgncihtltghqsltsgmelkdnilvsgnadstvk
iwdiktgqclqtlqgpnkhqsavtclqfnknfvitssddgtvklwdlktgefirnlvtle
sggsggvvwrirasntklvcavgsrngteetkllvldfdvdm

SCOPe Domain Coordinates for d2ovrb2:

Click to download the PDB-style file with coordinates for d2ovrb2.
(The format of our PDB-style files is described here.)

Timeline for d2ovrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovrb1