Class a: All alpha proteins [46456] (284 folds) |
Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) |
Family a.158.1.1: F-box domain [81381] (4 proteins) |
Protein F-box/WD repeat-containing protein 7, FBXW7 [158808] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158809] (3 PDB entries) Uniprot Q969H0 263-364 |
Domain d2ovrb1: 2ovr B:2263-2364 [145735] Other proteins in same PDB: d2ovra1, d2ovra2, d2ovrb2 automatically matched to 2OVP B:2263-2364 complexed with so4 |
PDB Entry: 2ovr (more details), 2.5 Å
SCOPe Domain Sequences for d2ovrb1:
Sequence, based on SEQRES records: (download)
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr ekckeegideplhikrrkvikpgfihspwksayirqhridtn
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr ekckeegideplhikrvikpgfihspwksayirqhridtn
Timeline for d2ovrb1: