Lineage for d2ovrb1 (2ovr B:2263-2364)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100912Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 1100913Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 1100914Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 1100919Protein F-box/WD repeat-containing protein 7, FBXW7 [158808] (1 species)
  7. 1100920Species Human (Homo sapiens) [TaxId:9606] [158809] (3 PDB entries)
    Uniprot Q969H0 263-364
  8. 1100921Domain d2ovrb1: 2ovr B:2263-2364 [145735]
    Other proteins in same PDB: d2ovra1, d2ovra2, d2ovrb2
    automatically matched to 2OVP B:2263-2364
    complexed with so4

Details for d2ovrb1

PDB Entry: 2ovr (more details), 2.5 Å

PDB Description: Structure of the Skp1-Fbw7-CyclinEdegN complex
PDB Compounds: (B:) F-box/WD repeat protein 7

SCOPe Domain Sequences for d2ovrb1:

Sequence, based on SEQRES records: (download)

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}
tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr
ekckeegideplhikrrkvikpgfihspwksayirqhridtn

Sequence, based on observed residues (ATOM records): (download)

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}
tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr
ekckeegideplhikrvikpgfihspwksayirqhridtn

SCOPe Domain Coordinates for d2ovrb1:

Click to download the PDB-style file with coordinates for d2ovrb1.
(The format of our PDB-style files is described here.)

Timeline for d2ovrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovrb2