SCOPe 2.02: Domain d2ovqb2: 2ovq B:2365-2706

Lineage for d2ovqb2 (2ovq B:2365-2706)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (3 families)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (11 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein F-box/WD repeat-containing protein 7, FBXW7 [159259] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159260] (3 PDB entries)
   Uniprot Q969H0 365-706

8. Domain d2ovqb2: 2ovq B:2365-2706 [145734]
   Other proteins in same PDB: d2ovqa1, d2ovqa2, d2ovqb1
   automatically matched to 2OVP B:2365-2706
   complexed with so4

Details for d2ovqb2

PDB Entry: 2ovq, 2.6 Å

PDB Description: structure of the skp1-fbw7-cyclinedegc complex

PDB Compounds: (B:) F-box/WD repeat protein 7

SCOPe Domain Sequences for d2ovqb2:

Sequence; same for both SEQRES and ATOM records:

>d2ovqb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}
wrrgelkspkvlkghddhvitclqfcgnrivsgsddntlkvwsavtgkclrtlvghtggv
wssqmrdniiisgstdrtlkvwnaetgecihtlyghtstvrcmhlhekrvvsgsrdatlr
vwdietgqclhvlmghvaavrcvqydgrrvvsgaydfmvkvwdpetetclhtlqghtnrv
yslqfdgihvvsgsldtsirvwdvetgncihtltghqsltsgmelkdnilvsgnadstvk
iwdiktgqclqtlqgpnkhqsavtclqfnknfvitssddgtvklwdlktgefirnlvtle
sggsggvvwrirasntklvcavgsrngteetkllvldfdvdm

Timeline for d2ovqb2:

• d2ovqb2 first appeared in SCOP 1.75
  
• d2ovqb2 appears in SCOPe 2.01
  
• d2ovqb2 appears in SCOPe 2.03
  
• d2ovqb2 appears in the current release, SCOPe 2.08