Lineage for d2ovqb1 (2ovq B:2263-2364)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284752Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 1284753Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 1284754Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 1284761Protein F-box/WD repeat-containing protein 7, FBXW7 [158808] (1 species)
  7. 1284762Species Human (Homo sapiens) [TaxId:9606] [158809] (3 PDB entries)
    Uniprot Q969H0 263-364
  8. 1284764Domain d2ovqb1: 2ovq B:2263-2364 [145733]
    Other proteins in same PDB: d2ovqa1, d2ovqa2, d2ovqb2
    automatically matched to 2OVP B:2263-2364
    complexed with so4

Details for d2ovqb1

PDB Entry: 2ovq (more details), 2.6 Å

PDB Description: structure of the skp1-fbw7-cyclinedegc complex
PDB Compounds: (B:) F-box/WD repeat protein 7

SCOPe Domain Sequences for d2ovqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovqb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}
tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr
ekckeegideplhikrrkvikpgfihspwksayirqhridtn

SCOPe Domain Coordinates for d2ovqb1:

Click to download the PDB-style file with coordinates for d2ovqb1.
(The format of our PDB-style files is described here.)

Timeline for d2ovqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovqb2