SCOPe 2.02: Domain d2ovqb1: 2ovq B:2263-2364

Lineage for d2ovqb1 (2ovq B:2263-2364)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.158: F-box domain [81385] (1 superfamily)
   multihelical; interlocked heterodimer with the Skp1 dimerisation domain

4. Superfamily a.158.1: F-box domain [81383] (1 family)

5. Family a.158.1.1: F-box domain [81381] (4 proteins)

6. Protein F-box/WD repeat-containing protein 7, FBXW7 [158808] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158809] (3 PDB entries)
   Uniprot Q969H0 263-364

8. Domain d2ovqb1: 2ovq B:2263-2364 [145733]
   Other proteins in same PDB: d2ovqa1, d2ovqa2, d2ovqb2
   automatically matched to 2OVP B:2263-2364
   complexed with so4

Details for d2ovqb1

PDB Entry: 2ovq, 2.6 Å

PDB Description: structure of the skp1-fbw7-cyclinedegc complex

PDB Compounds: (B:) F-box/WD repeat protein 7

SCOPe Domain Sequences for d2ovqb1:

Sequence; same for both SEQRES and ATOM records:

>d2ovqb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}
tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr
ekckeegideplhikrrkvikpgfihspwksayirqhridtn

Timeline for d2ovqb1:

• d2ovqb1 first appeared in SCOP 1.75
  
• d2ovqb1 appears in SCOPe 2.01
  
• d2ovqb1 appears in SCOPe 2.03
  
• d2ovqb1 appears in the current release, SCOPe 2.08