![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (3 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (11 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein F-box/WD repeat-containing protein 7, FBXW7 [159259] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159260] (3 PDB entries) Uniprot Q969H0 365-706 |
![]() | Domain d2ovpb2: 2ovp B:2365-2706 [145732] Other proteins in same PDB: d2ovpa1, d2ovpa2, d2ovpb1 |
PDB Entry: 2ovp (more details), 2.9 Å
SCOPe Domain Sequences for d2ovpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ovpb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} wrrgelkspkvlkghddhvitclqfcgnrivsgsddntlkvwsavtgkclrtlvghtggv wssqmrdniiisgstdrtlkvwnaetgecihtlyghtstvrcmhlhekrvvsgsrdatlr vwdietgqclhvlmghvaavrcvqydgrrvvsgaydfmvkvwdpetetclhtlqghtnrv yslqfdgihvvsgsldtsirvwdvetgncihtltghqsltsgmelkdnilvsgnadstvk iwdiktgqclqtlqgpnkhqsavtclqfnknfvitssddgtvklwdlktgefirnlvtle sggsggvvwrirasntklvcavgsrngteetkllvldfdvdm
Timeline for d2ovpb2: