Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab21 [142285] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142286] (3 PDB entries) Uniprot Q9UL25 16-182 |
Domain d2ot3b1: 2ot3 B:17-182 [145726] Other proteins in same PDB: d2ot3a_ |
PDB Entry: 2ot3 (more details), 2.1 Å
SCOPe Domain Sequences for d2ot3b1:
Sequence, based on SEQRES records: (download)
>d2ot3b1 c.37.1.8 (B:17-182) Rab21 {Human (Homo sapiens) [TaxId: 9606]} aysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiwdta gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmie
>d2ot3b1 c.37.1.8 (B:17-182) Rab21 {Human (Homo sapiens) [TaxId: 9606]} aysfkvvllgegcvgktslvlrycttlqasfltkklniggkrvnlaiwdtagqerfhalg piyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvsiq eaesyaesvgakhyhtsakqnkgieelfldlckrmie
Timeline for d2ot3b1: