Lineage for d2ny6a1 (2ny6 A:83-491)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878722Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 878723Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 878724Family d.172.1.1: gp120 core [56503] (1 protein)
  6. 878725Protein gp120 core [56504] (1 species)
  7. 878726Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (20 PDB entries)
  8. 878747Domain d2ny6a1: 2ny6 A:83-491 [145708]
    Other proteins in same PDB: d2ny6b1, d2ny6b2, d2ny6c1, d2ny6c2, d2ny6d1, d2ny6d2
    complexed with nag, suc; mutant

Details for d2ny6a1

PDB Entry: 2ny6 (more details), 2.8 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, i109c, t123c, t257s, v275c,s334a, s375w, q428c, g431c) complexed with cd4 and antibody 17b
PDB Compounds: (A:) envelope glycoprotein gp120

SCOP Domain Sequences for d2ny6a1:

Sequence, based on SEQRES records: (download)

>d2ny6a1 d.172.1.1 (A:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhedicslwdqslkpcvklcplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfnstwstegsnntegsdtit
lpcrikqiinmwckvckamyappisgqircssnitgllltrdggnsnneseifrpgggdm
rdnwrselykykvvki

Sequence, based on observed residues (ATOM records): (download)

>d2ny6a1 d.172.1.1 (A:83-491) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnwckndmveqmhedicslwdqslkpcvklcplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvssqlllngsla
eeevvirscnftdnaktiivqlntsveinctgaghcniarakwnntlkqiasklreqfgn
nktiifkqssggdpeivthwfncggeffycnstqlfnstwfngsdtitlpcrikqiinmw
ckvckamyappisgqircssnitgllltrdggnsnneseifrpgggdmrdnwrselykyk
vvki

SCOP Domain Coordinates for d2ny6a1:

Click to download the PDB-style file with coordinates for d2ny6a1.
(The format of our PDB-style files is described here.)

Timeline for d2ny6a1: