![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries) Uniprot P19483 |
![]() | Domain d2jdia2: 2jdi A:24-94 [145684] Other proteins in same PDB: d2jdia1, d2jdia3, d2jdib1, d2jdib3, d2jdic1, d2jdic3, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig_, d2jdih1, d2jdih2, d2jdii_ automated match to d1w0ja2 complexed with anp, mg |
PDB Entry: 2jdi (more details), 1.9 Å
SCOPe Domain Sequences for d2jdia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik egdivkrtgai
Timeline for d2jdia2: