Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
Protein Uracil-DNA glycosylase [52143] (5 species) |
Species Epstein-Barr virus [TaxId:10376] [159461] (1 PDB entry) Uniprot Q777D9 26-255 |
Domain d2j8xa1: 2j8x A:26-255 [145675] Other proteins in same PDB: d2j8xb_, d2j8xd_ protein/DNA complex; complexed with ure |
PDB Entry: 2j8x (more details), 2.3 Å
SCOPe Domain Sequences for d2j8xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8xa1 c.18.1.1 (A:26-255) Uracil-DNA glycosylase {Epstein-Barr virus [TaxId: 10376]} enlllpdlwldflqlspifqrklaaviacvrrlrtqatvypeedmcmawarfcdpsdikv vilgqdpyhggqanglafsvaygfpvppslrniyaelhrslpefsppdhgcldawasqgv lllntiltvqkgkpgshadigwawftdhvisllserlkacvfmlwgakagdkaslinskk hlvltsqhpsplaqnstrksaqqkflgnnhfvlannflrekglgeidwrl
Timeline for d2j8xa1: