Lineage for d2j7qa1 (2j7q A:1-232)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851809Family d.3.1.20: M48USP-like [159852] (1 protein)
    Pfam PF04843; Herpesvirus tegument protein, N-terminal conserved region
  6. 851810Protein Tegument protein M48; N-terminal domain [159853] (1 species)
  7. 851811Species Murine cytomegalovirus (MCMV) [TaxId:10366] [159854] (1 PDB entry)
    Uniprot A8E1C4 1-232
  8. 851812Domain d2j7qa1: 2j7q A:1-232 [145673]
    Other proteins in same PDB: d2j7qb1, d2j7qd1
    complexed with gol, gve, mg, pg4

Details for d2j7qa1

PDB Entry: 2j7q (more details), 1.8 Å

PDB Description: crystal structure of the ubiquitin-specific protease encoded by murine cytomegalovirus tegument protein m48 in complex with a ubquitin-based suicide substrate
PDB Compounds: (A:) mcmv tegument protein m48 encoded ubiquitin-specific protease, m48usp

SCOP Domain Sequences for d2j7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7qa1 d.3.1.20 (A:1-232) Tegument protein M48; N-terminal domain {Murine cytomegalovirus (MCMV) [TaxId: 10366]}
mkivrasrdqsapvygpragsqcmsncftflhtcylmgidpvldttsldavldsgarlda
iadekvkrqaltdhpyrlgteiptvietpagitghalsrpfngtaetqdlggykclgild
fltyargkplpvyiivtvgvhtrgvivargatyvfdphttdlsaeaavyvcddfteaisa
lsfftemigdfyydavlvyftrcrttlispsellvqimdqykdpdidasvms

SCOP Domain Coordinates for d2j7qa1:

Click to download the PDB-style file with coordinates for d2j7qa1.
(The format of our PDB-style files is described here.)

Timeline for d2j7qa1: