SCOP 1.75: Domain d2j6em2: 2j6e M:109-210

Lineage for d2j6em2 (2j6e M:109-210)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d2j6em2: 2j6e M:109-210 [145672]
   Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6em1
   automatically matched to 2J6E L:109-210
   complexed with act, bma, cac, cd, ful, gal, man, mpd, nag, ndg, zn

Details for d2j6em2

PDB Entry: 2j6e, 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation

PDB Compounds: (M:) igm

SCOP Domain Sequences for d2j6em2:

Sequence; same for both SEQRES and ATOM records:

>d2j6em2 b.1.1.2 (M:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdffpgavtvawkadgapvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d2j6em2:

• d2j6em2 is new in SCOP 1.75
  
• d2j6em2 appears in SCOPe 2.01
  
• d2j6em2 appears in the current release, SCOPe 2.08