SCOPe 2.07: Domain d2j6em1: 2j6e M:1-108

Lineage for d2j6em1 (2j6e M:1-108)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2j6em1: 2j6e M:1-108 [145671]
   Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei1, d2j6el1, d2j6el2, d2j6em2
   automated match to d2mcg11
   complexed with act, cac, cd, mpd, zn

Details for d2j6em1

PDB Entry: 2j6e, 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation

PDB Compounds: (M:) igm

SCOPe Domain Sequences for d2j6em1:

Sequence; same for both SEQRES and ATOM records:

>d2j6em1 b.1.1.0 (M:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvp
drfsgsksgtsaslaisglrsedeadyycatwddslsavifgggtkltvlg

Timeline for d2j6em1:

• d2j6em1 first appeared in SCOP 1.75
  
• d2j6em1 appears in SCOPe 2.06
  
• d2j6em1 appears in the current release, SCOPe 2.08