Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d2j6em1: 2j6e M:1-108 [145671] Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei1, d2j6el1, d2j6el2, d2j6em2 automated match to d2mcg11 complexed with act, cac, cd, mpd, zn |
PDB Entry: 2j6e (more details), 3 Å
SCOPe Domain Sequences for d2j6em1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j6em1 b.1.1.0 (M:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsvltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvp drfsgsksgtsaslaisglrsedeadyycatwddslsavifgggtkltvlg
Timeline for d2j6em1: