SCOP 1.75: Domain d2j6em1: 2j6e M:1-108

Lineage for d2j6em1 (2j6e M:1-108)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)

8. Domain d2j6em1: 2j6e M:1-108 [145671]
   Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el2, d2j6em2
   automatically matched to 2J6E L:1-108
   complexed with act, bma, cac, cd, ful, gal, man, mpd, nag, ndg, zn

Details for d2j6em1

PDB Entry: 2j6e, 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation

PDB Compounds: (M:) igm

SCOP Domain Sequences for d2j6em1:

Sequence; same for both SEQRES and ATOM records:

>d2j6em1 b.1.1.1 (M:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
qsvltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvp
drfsgsksgtsaslaisglrsedeadyycatwddslsavifgggtkltvlg

Timeline for d2j6em1:

• d2j6em1 is new in SCOP 1.75
  
• d2j6em1 appears in SCOPe 2.01
  
• d2j6em1 appears in the current release, SCOPe 2.08