Lineage for d2j6el1 (2j6e L:1-108)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931241Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 931254Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)
  8. 931268Domain d2j6el1: 2j6e L:1-108 [145669]
    Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el2, d2j6em2
    complexed with act, cac, cd, mpd, zn

Details for d2j6el1

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (L:) igm

SCOPe Domain Sequences for d2j6el1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6el1 b.1.1.1 (L:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
qsvltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvp
drfsgsksgtsaslaisglrsedeadyycatwddslsavifgggtkltvlg

SCOPe Domain Coordinates for d2j6el1:

Click to download the PDB-style file with coordinates for d2j6el1.
(The format of our PDB-style files is described here.)

Timeline for d2j6el1: