SCOPe 2.01: Domain d2j6ei2: 2j6e I:114-214

Lineage for d2j6ei2 (2j6e I:114-214)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)

8. Domain d2j6ei2: 2j6e I:114-214 [145668]
   Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6ei1, d2j6el1, d2j6el2, d2j6em1, d2j6em2
   automatically matched to 2J6E H:114-214
   complexed with act, cac, cd, mpd, zn

Details for d2j6ei2

PDB Entry: 2j6e, 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation

PDB Compounds: (I:) igm

SCOPe Domain Sequences for d2j6ei2:

Sequence; same for both SEQRES and ATOM records:

>d2j6ei2 b.1.1.2 (I:114-214) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggky
aatsqvllpskdvmqgtdehvvckvqhpngnkeknvp

Timeline for d2j6ei2:

• d2j6ei2 first appeared in SCOP 1.75
  
• d2j6ei2 appears in SCOPe 2.02
  
• d2j6ei2 appears in the current release, SCOPe 2.08