Lineage for d2j6ei1 (2j6e I:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743494Domain d2j6ei1: 2j6e I:1-113 [145667]
    Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6eh2, d2j6ei2, d2j6el1, d2j6el2, d2j6em1, d2j6em2
    automated match to d2j6eh1
    complexed with act, cac, cd, mpd, zn

Details for d2j6ei1

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (I:) igm

SCOPe Domain Sequences for d2j6ei1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ei1 b.1.1.1 (I:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlqlqesgpglvkpsetlsltctvsggsisrgshywgwirqppgkglewigsiyysgnty
fnpslksrvtisvdtsknqfslklssvtaadtavyycarlgpddytldgmdvwgqgttvt
vss

SCOPe Domain Coordinates for d2j6ei1:

Click to download the PDB-style file with coordinates for d2j6ei1.
(The format of our PDB-style files is described here.)

Timeline for d2j6ei1: