Lineage for d2j6eh1 (2j6e H:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739896Species Human (Homo sapiens), cluster 2.2 [TaxId:9606] [88546] (2 PDB entries)
  8. 2739897Domain d2j6eh1: 2j6e H:1-113 [145665]
    Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6el2, d2j6em1, d2j6em2
    complexed with act, cac, cd, mpd, zn

Details for d2j6eh1

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (H:) igm

SCOPe Domain Sequences for d2j6eh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6eh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.2 [TaxId: 9606]}
qlqlqesgpglvkpsetlsltctvsggsisrgshywgwirqppgkglewigsiyysgnty
fnpslksrvtisvdtsknqfslklssvtaadtavyycarlgpddytldgmdvwgqgttvt
vss

SCOPe Domain Coordinates for d2j6eh1:

Click to download the PDB-style file with coordinates for d2j6eh1.
(The format of our PDB-style files is described here.)

Timeline for d2j6eh1: