Lineage for d2j5lc1 (2j5l C:1-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756016Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1756072Domain d2j5lc1: 2j5l C:1-112 [145663]
    Other proteins in same PDB: d2j5la1, d2j5lb1, d2j5lb2, d2j5lc2
    automated match to d2j4wh1

Details for d2j5lc1

PDB Entry: 2j5l (more details), 2.9 Å

PDB Description: structure of a plasmodium falciparum apical membrane antigen 1-fab f8. 12.19 complex
PDB Compounds: (C:) fab fragment of monoclonal antibody f8.12.19

SCOPe Domain Sequences for d2j5lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5lc1 b.1.1.1 (C:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggglvkpggslklscaasgfifsdyymywvrqtpekrlewvatisdgnsytyy
vdsvkgrftisrdnaknnlylqmsslksedtaiyycardgptdssgyggfgywgqgtlvt
vs

SCOPe Domain Coordinates for d2j5lc1:

Click to download the PDB-style file with coordinates for d2j5lc1.
(The format of our PDB-style files is described here.)

Timeline for d2j5lc1: