Lineage for d2j59q_ (2j59 Q:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2070982Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2071145Protein Rho GTPase-activating protein 21 [159213] (1 species)
  7. 2071146Species Human (Homo sapiens) [TaxId:9606] [159214] (1 PDB entry)
    Uniprot Q5T5U3 931-1063
  8. 2071151Domain d2j59q_: 2j59 Q: [145660]
    Other proteins in same PDB: d2j59a2, d2j59a3, d2j59b2, d2j59b3, d2j59c2, d2j59c3, d2j59d2, d2j59d3, d2j59e2, d2j59e3, d2j59f2, d2j59f3
    automated match to d2j59m1
    complexed with dio, edo, gtp, mg, so4

Details for d2j59q_

PDB Entry: 2j59 (more details), 2.1 Å

PDB Description: crystal structure of the arf1:arhgap21-arfbd complex
PDB Compounds: (Q:) rho-gtpase activating protein 10

SCOPe Domain Sequences for d2j59q_:

Sequence, based on SEQRES records: (download)

>d2j59q_ b.55.1.1 (Q:) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpisv
naclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvtnr
dlisrrikeynnl

Sequence, based on observed residues (ATOM records): (download)

>d2j59q_ b.55.1.1 (Q:) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvpwkqmyvvlrghslylykdkreqqpisvnaclidisysetkrknvfr
lttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl

SCOPe Domain Coordinates for d2j59q_:

Click to download the PDB-style file with coordinates for d2j59q_.
(The format of our PDB-style files is described here.)

Timeline for d2j59q_: