| Class b: All beta proteins [48724] (177 folds) |
| Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
| Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
| Protein Rho GTPase-activating protein 21 [159213] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [159214] (1 PDB entry) Uniprot Q5T5U3 931-1063 |
| Domain d2j59q_: 2j59 Q: [145660] Other proteins in same PDB: d2j59a2, d2j59a3, d2j59b2, d2j59b3, d2j59c2, d2j59c3, d2j59d2, d2j59d3, d2j59e2, d2j59e3, d2j59f2, d2j59f3 automated match to d2j59m1 complexed with dio, edo, gtp, mg, so4 |
PDB Entry: 2j59 (more details), 2.1 Å
SCOPe Domain Sequences for d2j59q_:
Sequence, based on SEQRES records: (download)
>d2j59q_ b.55.1.1 (Q:) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpisv
naclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvtnr
dlisrrikeynnl
>d2j59q_ b.55.1.1 (Q:) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvpwkqmyvvlrghslylykdkreqqpisvnaclidisysetkrknvfr
lttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl
Timeline for d2j59q_: