Lineage for d2j59m1 (2j59 M:931-1063)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1550802Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1550965Protein Rho GTPase-activating protein 21 [159213] (1 species)
  7. 1550966Species Human (Homo sapiens) [TaxId:9606] [159214] (1 PDB entry)
    Uniprot Q5T5U3 931-1063
  8. 1550967Domain d2j59m1: 2j59 M:931-1063 [145656]
    Other proteins in same PDB: d2j59a_, d2j59b_, d2j59c_, d2j59d_, d2j59e_, d2j59f_
    complexed with dio, edo, gtp, mg, so4

Details for d2j59m1

PDB Entry: 2j59 (more details), 2.1 Å

PDB Description: crystal structure of the arf1:arhgap21-arfbd complex
PDB Compounds: (M:) rho-gtpase activating protein 10

SCOPe Domain Sequences for d2j59m1:

Sequence, based on SEQRES records: (download)

>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpisv
naclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvtnr
dlisrrikeynnl

Sequence, based on observed residues (ATOM records): (download)

>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvpwkqmyvvlrghslylykdkreqpisvnaclidisysetkrknvfrl
ttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl

SCOPe Domain Coordinates for d2j59m1:

Click to download the PDB-style file with coordinates for d2j59m1.
(The format of our PDB-style files is described here.)

Timeline for d2j59m1: