SCOPe 2.01: Domain d2j57m_: 2j57 M:

Lineage for d2j57m_ (2j57 M:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)

6. Protein automated matches [190303] (2 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:266] [187112] (5 PDB entries)

8. Domain d2j57m_: 2j57 M: [145654]
   Other proteins in same PDB: d2j57a_, d2j57b_, d2j57c_, d2j57d_, d2j57g1, d2j57h1, d2j57i1, d2j57j1
   automated match to d1mg2b_
   complexed with cu

Details for d2j57m_

PDB Entry: 2j57, 2.25 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-quinol in complex with amicyanin.

PDB Compounds: (M:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d2j57m_:

Sequence; same for both SEQRES and ATOM records:

>d2j57m_ g.21.1.1 (M:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d2j57m_:

• d2j57m_ first appeared in SCOP 1.75, called d2j57m1
  
• d2j57m_ appears in SCOPe 2.02
  
• d2j57m_ appears in the current release, SCOPe 2.08