Class g: Small proteins [56992] (90 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) |
Protein automated matches [190303] (2 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [187112] (5 PDB entries) |
Domain d2j57m_: 2j57 M: [145654] Other proteins in same PDB: d2j57a_, d2j57b_, d2j57c_, d2j57d_, d2j57g1, d2j57h1, d2j57i1, d2j57j1 automated match to d1mg2b_ complexed with cu |
PDB Entry: 2j57 (more details), 2.25 Å
SCOPe Domain Sequences for d2j57m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j57m_ g.21.1.1 (M:) automated matches {Paracoccus denitrificans [TaxId: 266]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d2j57m_: