Lineage for d2j56m_ (2j56 M:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261162Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2261163Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2261164Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2261221Protein automated matches [190303] (3 species)
    not a true protein
  7. 2261222Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries)
  8. 2261232Domain d2j56m_: 2j56 M: [145651]
    Other proteins in same PDB: d2j56a_, d2j56b_, d2j56h_, d2j56j_
    automated match to d1mg2b_
    complexed with cu, gol, na

Details for d2j56m_

PDB Entry: 2j56 (more details), 2.1 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-semiquinone in complex with amicyanin.
PDB Compounds: (M:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d2j56m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j56m_ g.21.1.1 (M:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d2j56m_:

Click to download the PDB-style file with coordinates for d2j56m_.
(The format of our PDB-style files is described here.)

Timeline for d2j56m_: