SCOPe 2.06: Domain d2j55m_: 2j55 M:

Lineage for d2j55m_ (2j55 M:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein automated matches [190303] (3 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries)

8. Domain d2j55m_: 2j55 M: [145649]
   Other proteins in same PDB: d2j55a_, d2j55b_, d2j55h_, d2j55j_, d2j55l1
   automated match to d1mg2b_
   complexed with cu, gol

Details for d2j55m_

PDB Entry: 2j55, 2.15 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase o-quinone in complex with amicyanin.

PDB Compounds: (M:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d2j55m_:

Sequence; same for both SEQRES and ATOM records:

>d2j55m_ g.21.1.1 (M:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d2j55m_:

• d2j55m_ first appeared in SCOP 1.75, called d2j55m1
  
• d2j55m_ appears in SCOPe 2.05
  
• d2j55m_ appears in SCOPe 2.07
  
• d2j55m_ appears in the current release, SCOPe 2.08