Lineage for d2j4wd1 (2j4w D:421-454)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589363Fold g.61: Apical membrane antigen 1 [82909] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 2589364Superfamily g.61.1: Apical membrane antigen 1 [82910] (1 family) (S)
  5. 2589365Family g.61.1.1: Apical membrane antigen 1 [82911] (1 protein)
  6. 2589366Protein Apical membrane antigen 1 [82912] (1 species)
  7. 2589367Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [82913] (3 PDB entries)
  8. 2589368Domain d2j4wd1: 2j4w D:421-454 [145645]
    Other proteins in same PDB: d2j4wh1, d2j4wh2, d2j4wl1, d2j4wl2

Details for d2j4wd1

PDB Entry: 2j4w (more details), 2.5 Å

PDB Description: structure of a plasmodium vivax apical membrane antigen 1-fab f8.12.19 complex
PDB Compounds: (D:) apical membrane antigen 1

SCOPe Domain Sequences for d2j4wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4wd1 g.61.1.1 (D:421-454) Apical membrane antigen 1 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ifisndkesikcpceperisestcnfyvcncvek

SCOPe Domain Coordinates for d2j4wd1:

Click to download the PDB-style file with coordinates for d2j4wd1.
(The format of our PDB-style files is described here.)

Timeline for d2j4wd1: