Lineage for d2j28h2 (2j28 H:1-58)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426018Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 1426019Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 1426020Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 1426021Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 1426029Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 1426056Domain d2j28h2: 2j28 H:1-58 [145630]
    Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1
    automatically matched to 2AW4 H:1-58
    protein/RNA complex; complexed with mg

Details for d2j28h2

PDB Entry: 2j28 (more details), 8 Å

PDB Description: model of e. coli srp bound to 70s rncs
PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2j28h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j28h2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d2j28h2:

Click to download the PDB-style file with coordinates for d2j28h2.
(The format of our PDB-style files is described here.)

Timeline for d2j28h2:

1426056
d2j28h2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2j28h1