SCOPe 2.06: Domain d2j28c2: 2j28 C:61-124

Lineage for d2j28c2 (2j28 C:61-124)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
   Uniprot P60422 3-124

8. Domain d2j28c2: 2j28 C:61-124 [145623]
   Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1
   automatically matched to 2AW4 C:61-124
   protein/RNA complex; complexed with mg

Details for d2j28c2

PDB Entry: 2j28, 8 Å

PDB Description: model of e. coli srp bound to 70s rncs

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2j28c2:

Sequence; same for both SEQRES and ATOM records:

>d2j28c2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

Timeline for d2j28c2:

• d2j28c2 first appeared in SCOP 1.75
  
• d2j28c2 appears in SCOPe 2.05
  
• d2j28c2 appears in SCOPe 2.07
  
• d2j28c2 appears in the current release, SCOPe 2.08