Class b: All beta proteins [48724] (174 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) |
Protein automated matches [190333] (3 species) not a true protein |
Species Canine adenovirus 2 [TaxId:10514] [187888] (3 PDB entries) |
Domain d2j1kr_: 2j1k R: [145620] Other proteins in same PDB: d2j1ka_, d2j1kb_, d2j1kc1, d2j1kg_, d2j1kj_, d2j1kk_, d2j1ko_, d2j1kp_, d2j1kt_, d2j1kv_, d2j1kx_, d2j1ky_, d2j1kz_ automated match to d2j1kc1 |
PDB Entry: 2j1k (more details), 2.3 Å
SCOPe Domain Sequences for d2j1kr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1kr_ b.21.1.1 (R:) automated matches {Canine adenovirus 2 [TaxId: 10514]} apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge nq
Timeline for d2j1kr_: