Lineage for d2j03t1 (2j03 T:1-138)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536931Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1537204Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein)
    Pfam PF01245
  6. 1537205Protein Ribosomal protein L19 [141246] (3 species)
  7. 1537223Species Thermus thermophilus [TaxId:274] [159030] (4 PDB entries)
    Uniprot P60490 1-138
  8. 1537224Domain d2j03t1: 2j03 T:1-138 [145603]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    automatically matched to 2J01 T:1-138
    protein/RNA complex

Details for d2j03t1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (T:) 50S ribosomal protein L19

SCOPe Domain Sequences for d2j03t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03t1 b.34.5.6 (T:1-138) Ribosomal protein L19 {Thermus thermophilus [TaxId: 274]}
mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
idqdraaeraakeeaqka

SCOPe Domain Coordinates for d2j03t1:

Click to download the PDB-style file with coordinates for d2j03t1.
(The format of our PDB-style files is described here.)

Timeline for d2j03t1: