Lineage for d2j03p1 (2j03 P:5-150)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460348Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2460349Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2460350Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2460351Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 2460430Species Thermus thermophilus [TaxId:274] [159454] (11 PDB entries)
    Uniprot Q72I23 5-150
  8. 2460431Domain d2j03p1: 2j03 P:5-150 [145599]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j03p1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (P:) 50S ribosomal protein L15

SCOPe Domain Sequences for d2j03p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03p1 c.12.1.1 (P:5-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]}
dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
vvahafsksaleklkaaggepvllea

SCOPe Domain Coordinates for d2j03p1:

Click to download the PDB-style file with coordinates for d2j03p1.
(The format of our PDB-style files is described here.)

Timeline for d2j03p1: