Lineage for d2j03f1 (2j03 F:1-208)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837604Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 1837605Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 1837606Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 1837607Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 1837690Species Thermus thermophilus [TaxId:274] [159476] (11 PDB entries)
    Uniprot Q5SHN9 1-208
  8. 1837691Domain d2j03f1: 2j03 F:1-208 [145594]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j03f1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (F:) 50S ribosomal protein L4

SCOPe Domain Sequences for d2j03f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03f1 c.22.1.1 (F:1-208) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]}
mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
lnvydivrterlvmdldawevfqnrigg

SCOPe Domain Coordinates for d2j03f1:

Click to download the PDB-style file with coordinates for d2j03f1.
(The format of our PDB-style files is described here.)

Timeline for d2j03f1: