Lineage for d2j0341 (2j03 4:1-50)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1948081Fold d.325: L28p-like [143799] (1 superfamily)
    unusual fold consisting of three beta-hairpins, that form a paper clip-like structure, and two helices; could have evolved from a glucocorticoid receptor-like zinc finger domain (57715)
  4. 1948082Superfamily d.325.1: L28p-like [143800] (2 families) (S)
    In early ribosomal structures, L28p has been misinterpreted as L31p. in the Ribosomal protein L28p family, there are sequences containing two CxxC pairs. Threading these sequences into this fold brings the four cysteines in a similar site to the zinc-binding site of glucocorticoid receptor-like zinc fingers. In the Ribosomal protein L31p, there are also members with two CxxC pairs. However, these won't form a putative zinc-binding site in this fold. The L31p family are classified here temporarily, until its true fold is known
  5. 1948115Family d.325.1.2: Ribosomal protein L31p [143804] (1 protein)
    Pfam PF01197
  6. 1948116Protein Ribosomal protein L31p [143805] (2 species)
  7. 1948127Species Thermus thermophilus [TaxId:274] [160711] (7 PDB entries)
    Uniprot Q5SJE1 1-50
  8. 1948128Domain d2j0341: 2j03 4:1-50 [145586]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j0341

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (4:) 50S ribosomal protein L31

SCOPe Domain Sequences for d2j0341:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0341 d.325.1.2 (4:1-50) Ribosomal protein L31p {Thermus thermophilus [TaxId: 274]}
mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfv

SCOPe Domain Coordinates for d2j0341:

Click to download the PDB-style file with coordinates for d2j0341.
(The format of our PDB-style files is described here.)

Timeline for d2j0341: