Lineage for d2j0331 (2j03 3:1-60)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912088Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 1912089Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 1912090Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 1912133Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 1912171Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)
  8. 1912174Domain d2j0331: 2j03 3:1-60 [145585]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j0331

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (3:) 50S ribosomal protein L30

SCOPe Domain Sequences for d2j0331:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0331 d.59.1.1 (3:1-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

SCOPe Domain Coordinates for d2j0331:

Click to download the PDB-style file with coordinates for d2j0331.
(The format of our PDB-style files is described here.)

Timeline for d2j0331: