Lineage for d2j0311 (2j03 1:8-96)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1948081Fold d.325: L28p-like [143799] (1 superfamily)
    unusual fold consisting of three beta-hairpins, that form a paper clip-like structure, and two helices; could have evolved from a glucocorticoid receptor-like zinc finger domain (57715)
  4. 1948082Superfamily d.325.1: L28p-like [143800] (2 families) (S)
    In early ribosomal structures, L28p has been misinterpreted as L31p. in the Ribosomal protein L28p family, there are sequences containing two CxxC pairs. Threading these sequences into this fold brings the four cysteines in a similar site to the zinc-binding site of glucocorticoid receptor-like zinc fingers. In the Ribosomal protein L31p, there are also members with two CxxC pairs. However, these won't form a putative zinc-binding site in this fold. The L31p family are classified here temporarily, until its true fold is known
  5. 1948083Family d.325.1.1: Ribosomal protein L28 [143801] (1 protein)
  6. 1948084Protein Ribosomal protein L28 (L28p) [143802] (4 species)
  7. 1948112Species Thermus thermophilus [TaxId:274] [143803] (2 PDB entries)
    Uniprot P60494 7-95
  8. 1948113Domain d2j0311: 2j03 1:8-96 [145584]
    Other proteins in same PDB: d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j0311

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (1:) 50S ribosomal protein L28

SCOPe Domain Sequences for d2j0311:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0311 d.325.1.1 (1:8-96) Ribosomal protein L28 (L28p) {Thermus thermophilus [TaxId: 274]}
sgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitfrvaashi
pkvyelverakglkleglspkeikkellk

SCOPe Domain Coordinates for d2j0311:

Click to download the PDB-style file with coordinates for d2j0311.
(The format of our PDB-style files is described here.)

Timeline for d2j0311: