Lineage for d2j01f1 (2j01 F:1-208)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825407Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 825408Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 825409Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 825410Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 825497Species Thermus thermophilus [TaxId:274] [159476] (7 PDB entries)
    Uniprot Q5SHN9 1-208
  8. 825498Domain d2j01f1: 2j01 F:1-208 [145567]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    Representative structure

Details for d2j01f1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (F:) 50S ribosomal protein L4

SCOP Domain Sequences for d2j01f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01f1 c.22.1.1 (F:1-208) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]}
mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
lnvydivrterlvmdldawevfqnrigg

SCOP Domain Coordinates for d2j01f1:

Click to download the PDB-style file with coordinates for d2j01f1.
(The format of our PDB-style files is described here.)

Timeline for d2j01f1: