Lineage for d2j0181 (2j01 8:2-65)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1231461Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 1231462Superfamily d.301.1: L35p-like [143034] (1 family) (S)
  5. 1231463Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 1231464Protein Ribosomal protein L35p [143036] (3 species)
  7. 1231500Species Thermus thermophilus [TaxId:274] [160057] (9 PDB entries)
    Uniprot P80341 1-64
  8. 1231502Domain d2j0181: 2j01 8:2-65 [145563]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    Representative structure
    protein/RNA complex

Details for d2j0181

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (8:) 50S ribosomal protein L35

SCOPe Domain Sequences for d2j0181:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0181 d.301.1.1 (8:2-65) Ribosomal protein L35p {Thermus thermophilus [TaxId: 274]}
pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
lpye

SCOPe Domain Coordinates for d2j0181:

Click to download the PDB-style file with coordinates for d2j0181.
(The format of our PDB-style files is described here.)

Timeline for d2j0181: