Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.301: L35p-like [143033] (1 superfamily) core: alpha-beta(3)-alpha; 2layers a/b |
Superfamily d.301.1: L35p-like [143034] (1 family) |
Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein) Pfam PF01632 |
Protein Ribosomal protein L35p [143036] (3 species) |
Species Thermus thermophilus [TaxId:274] [160057] (5 PDB entries) Uniprot P80341 1-64 |
Domain d2j0181: 2j01 8:2-65 [145563] Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1 Representative structure |
PDB Entry: 2j01 (more details), 2.8 Å
SCOP Domain Sequences for d2j0181:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0181 d.301.1.1 (8:2-65) Ribosomal protein L35p {Thermus thermophilus [TaxId: 274]} pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll lpye
Timeline for d2j0181:
View in 3D Domains from other chains: (mouse over for more information) d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1 |