Lineage for d2iwge_ (2iwg E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119627Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 1119628Protein 52 kDa Ro protein [158987] (1 species)
  7. 1119629Species Human (Homo sapiens) [TaxId:9606] [158988] (1 PDB entry)
    Uniprot P19474 287-465
  8. 1119631Domain d2iwge_: 2iwg E: [145549]
    Other proteins in same PDB: d2iwga1, d2iwga2, d2iwgd1, d2iwgd2
    automated match to d2iwgb1
    protein/DNA complex; protein/RNA complex; complexed with fu4

Details for d2iwge_

PDB Entry: 2iwg (more details), 2.35 Å

PDB Description: complex between the pryspry domain of trim21 and igg fc
PDB Compounds: (E:) 52 kda ro protein

SCOPe Domain Sequences for d2iwge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwge_ b.29.1.22 (E:) 52 kDa Ro protein {Human (Homo sapiens) [TaxId: 9606]}
hmvhitldpdtanpwlilsedrrqvrlgdtqqsipgneerfdsypmvlgaqhfhsgkhyw
evdvtgkeawdlgvcrdsvrrkghfllssksgfwtiwlwnkqkyeagtypqtplhlqvpp
cqvgifldyeagmvsfynitdhgsliysfsecaftgplrpffspgfndggkntapltlcp
l

SCOPe Domain Coordinates for d2iwge_:

Click to download the PDB-style file with coordinates for d2iwge_.
(The format of our PDB-style files is described here.)

Timeline for d2iwge_: