Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.22: SPRY domain [141154] (6 proteins) Pfam PF00622 |
Protein 52 kDa Ro protein [158987] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158988] (1 PDB entry) Uniprot P19474 287-465 |
Domain d2iwgb1: 2iwg B:4-182 [145548] Other proteins in same PDB: d2iwga1, d2iwga2, d2iwgd1, d2iwgd2 protein/DNA complex; protein/RNA complex; complexed with fu4 |
PDB Entry: 2iwg (more details), 2.35 Å
SCOPe Domain Sequences for d2iwgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwgb1 b.29.1.22 (B:4-182) 52 kDa Ro protein {Human (Homo sapiens) [TaxId: 9606]} vhitldpdtanpwlilsedrrqvrlgdtqqsipgneerfdsypmvlgaqhfhsgkhywev dvtgkeawdlgvcrdsvrrkghfllssksgfwtiwlwnkqkyeagtypqtplhlqvppcq vgifldyeagmvsfynitdhgsliysfsecaftgplrpffspgfndggkntapltlcpl
Timeline for d2iwgb1: