Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [88856] (128 PDB entries) Uniprot P24941 |
Domain d2iw6c1: 2iw6 C:1-295 [145543] Other proteins in same PDB: d2iw6b1, d2iw6b2, d2iw6d1, d2iw6d2 automatically matched to 2IW6 A:1-295 complexed with mg, qq2, sgm; mutant |
PDB Entry: 2iw6 (more details), 2.3 Å
SCOP Domain Sequences for d2iw6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iw6c1 d.144.1.7 (C:1-295) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
Timeline for d2iw6c1: