Lineage for d2iw6a1 (2iw6 A:1-295)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1929749Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1929750Species Human (Homo sapiens) [TaxId:9606] [88856] (348 PDB entries)
    Uniprot P24941
  8. 1930082Domain d2iw6a1: 2iw6 A:1-295 [145542]
    Other proteins in same PDB: d2iw6b1, d2iw6b2, d2iw6d1, d2iw6d2
    complexed with mg, qq2, sgm

Details for d2iw6a1

PDB Entry: 2iw6 (more details), 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor
PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d2iw6a1:

Sequence, based on SEQRES records: (download)

>d2iw6a1 d.144.1.7 (A:1-295) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph

Sequence, based on observed residues (ATOM records): (download)

>d2iw6a1 d.144.1.7 (A:1-295) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirltegvpstaireisllkelnhpni
vklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafchshrv
lhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyysta
vdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkw
arqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph

SCOPe Domain Coordinates for d2iw6a1:

Click to download the PDB-style file with coordinates for d2iw6a1.
(The format of our PDB-style files is described here.)

Timeline for d2iw6a1: