SCOPe 2.05: Domain d2io3c1: 2io3 C:432-587

Lineage for d2io3c1 (2io3 C:432-587)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family)
   automatically mapped to Pfam PF07834

5. Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)

6. Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
   Uniprot P46060 431-587! Uniprot P46060 432-587

8. Domain d2io3c1: 2io3 C:432-587 [145537]
   Other proteins in same PDB: d2io3a1, d2io3b1
   automatically matched to 2IO2 C:432-587

Details for d2io3c1

PDB Entry: 2io3, 3.2 Å

PDB Description: crystal structure of human senp2 in complex with rangap1-sumo-2

PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d2io3c1:

Sequence; same for both SEQRES and ATOM records:

>d2io3c1 a.118.12.1 (C:432-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalesssfarhsllqtlykv

Timeline for d2io3c1:

• d2io3c1 first appeared in SCOP 1.75
  
• d2io3c1 appears in SCOPe 2.04
  
• d2io3c1 appears in SCOPe 2.06
  
• d2io3c1 appears in the current release, SCOPe 2.08