SCOPe 2.01: Domain d2io1e_: 2io1 E:

Lineage for d2io1e_ (2io1 E:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110772] (6 PDB entries)
   Uniprot Q9HC62 366-589

8. Domain d2io1e_: 2io1 E: [145533]
   Other proteins in same PDB: d2io1b_, d2io1d_, d2io1f_
   automated match to d2io0a1

Details for d2io1e_

PDB Entry: 2io1, 2.6 Å

PDB Description: crystal structure of human senp2 in complex with presumo-3

PDB Compounds: (E:) Sentrin-specific protease 2

SCOPe Domain Sequences for d2io1e_:

Sequence; same for both SEQRES and ATOM records:

>d2io1e_ d.3.1.7 (E:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

Timeline for d2io1e_:

• d2io1e_ first appeared in SCOP 1.75, called d2io1e1
  
• d2io1e_ appears in SCOPe 2.02
  
• d2io1e_ appears in the current release, SCOPe 2.08