Class a: All alpha proteins [46456] (284 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [158690] (1 PDB entry) Uniprot O15492 65-184 |
Domain d2ik8d_: 2ik8 D: [145529] Other proteins in same PDB: d2ik8a1, d2ik8a2, d2ik8c1, d2ik8c2 automated match to d2ik8b1 complexed with alf, gdp, mg, so4 |
PDB Entry: 2ik8 (more details), 2.71 Å
SCOPe Domain Sequences for d2ik8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ik8d_ a.91.1.1 (D:) Regulator of G-protein signaling 16, RGS16 {Human (Homo sapiens) [TaxId: 9606]} fsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkirsatklasra hqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmekdsyprflks payrdlaaqa
Timeline for d2ik8d_: