SCOPe 2.05: Domain d2ij0e_: 2ij0 E:

Lineage for d2ij0e_ (2ij0 E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries)

8. Domain d2ij0e_: 2ij0 E: [145526]
   Other proteins in same PDB: d2ij0a1, d2ij0a2, d2ij0b1, d2ij0b2
   automated match to d2ij0c1

Details for d2ij0e_

PDB Entry: 2ij0, 2.25 Å

PDB Description: Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1

PDB Compounds: (E:) penultimate affinity-matured variant of hVbeta 2.1, D10

SCOPe Domain Sequences for d2ij0e_:

Sequence; same for both SEQRES and ATOM records:

>d2ij0e_ b.1.1.1 (E:) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gavvsqhpsmvivksgtsvkiecrsldtnihtmfwyrqfpkqslmlmatshqgfnaiyeq
gvvkdkflinhasptlstltvtsahpedsgfyvcsalagsgsstdtqyfgpgtqltvl

Timeline for d2ij0e_:

• d2ij0e_ first appeared in SCOP 1.75, called d2ij0e1
  
• d2ij0e_ appears in SCOPe 2.04
  
• d2ij0e_ appears in SCOPe 2.06
  
• d2ij0e_ appears in the current release, SCOPe 2.08