Lineage for d2icwl_ (2icw L:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290351Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)
  8. 1290478Domain d2icwl_: 2icw L: [145522]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj1
    automated match to d2icwj1

Details for d2icwl_

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (L:) T-cell receptor beta chain V

SCOPe Domain Sequences for d2icwl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwl_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdipd
gykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvlssa

SCOPe Domain Coordinates for d2icwl_:

Click to download the PDB-style file with coordinates for d2icwl_.
(The format of our PDB-style files is described here.)

Timeline for d2icwl_: