![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries) |
![]() | Domain d2icwl1: 2icw L:3-113 [145522] Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwg1, d2icwh1 automatically matched to 2ICW J:1-113 mutant |
PDB Entry: 2icw (more details), 2.41 Å
SCOP Domain Sequences for d2icwl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icwl1 b.1.1.1 (L:3-113) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdipd gykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvlssa
Timeline for d2icwl1: