![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (615 PDB entries) |
![]() | Domain d2icwl2: 2icw L:3-110 [145522] Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwj2, d2icwl3 automated match to d2icwj1 |
PDB Entry: 2icw (more details), 2.41 Å
SCOPe Domain Sequences for d2icwl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icwl2 b.1.1.1 (L:3-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdipd gykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
Timeline for d2icwl2: